Brand:SC
Model:Glucagon 1-29
MOQ:10 Gram
Send Inquiry
Email:alanyi@ycphar.com
Whatsapp:86-17301869715
Skype:iceliaoyi
| Product Name: | Glucagon |
| Synonyms: | GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN |
| CAS: | 16941-32-5 |
| MF: | C153H225N43O49S |
| MW: | 3482.75 |
| EINECS: | 232-708-2 |
| Product Categories: | Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research |
| Usage: | Glucagon is a promoting hormone catabolism, glucagon has very strong promoting glycogenolysis and gluconeogenesis, make blood sugar rise significantly, activation of liver cells phosphorylase, acceleration of glycogenolysis, glucagon can also activate lipases, promote fat decomposition, and can enhance fat acid oxidation, so that ketogenesis increase, in addition, the secretion of glucagon may promote insulin and islet somatostatin. |
Price: How many do you need? It depends on your amount of order for goods, the bigger the amount is, the more favorable the price.
Product: As a manufacturer, we can provide you the product directly, no middleman, so the price is more favorable.
Service: Good after-sales service is an important factor to ensure that we can long-term cooperation, We will provide customers with reasonable return service.
| Description: Glucagon is also known as glucagon or anti insulin or insulin B. It is accompanied by a hormone insulin secretion from pancreatic islet alpha cells of vertebrates. Confrontation and insulin plays a role, increase blood glucose. In 1953, was isolated by precipitation and obtain the crystallization. It is based on the N- terminal histidine as a starting point, C terminal threonine is a single chain peptide terminus of 29 amino acids (molecular weight is about 3500), does not have the S-S bonds in a molecule, at this point, completely different from insulin. The structure of the compound has been synthesized by chemical recent affirmation. The early effect of glucagon process is specific binding exists in the target cell receptors on the cell membrane, the adenylate cyclase activation, ring type AMP as the second messenger activating phosphorylase, promoting glycogenolysis. |
Recommended products:
| Test Raw Powder: Test CAS: 58-22-0 Test Undecanoate CAS: 5949-44-0 Test Acetate CAS: 1045-69-8 Test Propionate CAS: 57-85-2 Test Cypionate CAS:58-20-8 Test Isocaproate CAS:15262-86-9 Test phenylpropionate CAS:1255-49-8 Test Enanthate CAS: 315-37-7 Test Blend (Sustanon 250) Clostebol Acetate (Turinabol) CAS:855-19-6 FluoHalotestin CAS:1424-00-6 Test decanoate CAS:5721-91-5 |
Nandrlone Raw Powder:
| Nandrlone CAS:434-22-0 Nandrlone Decanoate (DECA) Deca-Durabolin CAS: 360-70-3 Nandrlone Phenylpropionate CAS:62-90-8 Nandrlone Propionate CAS:62-90-8 Nandrlone Cypionate CAS:601-63-8 Nandrlone Undecanoate CAS:862-89-598 Stanolone (Androstanolone) CAS:521-18-6 |
TrenboloneRaw Powder:
| Trblo Hexahydrobenzyl Carbonate Parabolan CAS: 23454-33-3 Trblo acetate Finaplix CAS:10161-34-9 Trblo enanthate CAS:10161-34-9 Trblo base CAS:10161-33-8 Trestolone CAS:3764-87-2 |
Anti-Estrogen:
Tamoxifen Citrate Novadex 54965-24-1
Clomifene citrate Serophene 50-41-9
Man Sex Enhancement:
Tadalafil 171596-29-5
Vardenafil 224785-91-5
Dapoxetine (Priligy) 119356-77-3
Best Sellers:
| T3 Na Liothyronine sodium Cytomel CAS: 55-06-1 CAS:434-07-1 Stanolone CAS:521-18-6 metandienone Dianabol CAS:72-63-9 Dextromethorphan Hydrobromide CAS:125-69-9 Methenolone Acetate CAS:434-05-9 1,3-Dimethylpentylamine CAS:105-41-9 Methenolone Enanthate CAS:303-42-4 Boldenone Undecylenate EQ CAS:13103-34-9 Drostanolone propionate CAS:521-12-0 Drostanolone Enanthate CAS:472-61-145 Yohimbine Hydrochloride CAS:65-19-0 1, 3 - dimethyleamine hydrochloride |
